Structure of PDB 8kd6 Chain S

Receptor sequence
>8kd6S (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQ
SSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGE
3D structure
PDB8kd6 Structural basis of nucleosome deacetylation and DNA linker tightening by Rpd3S histone deacetylase complex.
ChainS
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna S R40 R42 R72 F84 Q85 R116 V117 R5 R7 R37 F49 Q50 R81 V82
BS02 dna S H39 R40 Y41 P43 V46 R49 K64 L65 P66 R69 H4 R5 Y6 P8 V11 R14 K29 L30 P31 R34
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8kd6, PDBe:8kd6, PDBj:8kd6
PDBsum8kd6
PubMed37666978
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]