Structure of PDB 8i7j Chain S

Receptor sequence

>8i7jS (length=145) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKAD
VDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSL
ANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA

3D structure

• PDB: 8i7j Yeast eukaryotic initiation factor 4B remodels the mRNA entry site on the small ribosomal subunit
• Chain: S
• Resolution: 4.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	N25 I26 Y30 R36 G37 G39 R40 R41 R57 W84 F85 N87 R88 Q89 K90 H122 R123 R132 V133 R134 G135 Q136 H137 T138 K139 T141 R143 R144 R145	N24 I25 Y29 R35 G36 G38 R39 R40 R56 W83 F84 N86 R87 Q88 K89 H121 R122 R131 V132 R133 G134 Q135 H136 T137 K138 T140 R142 R143 R144

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8i7j, PDBe:8i7j, PDBj:8i7j
• PDBsum: 8i7j
• UniProt: Q6CWT9