Structure of PDB 8fn2 Chain S

Receptor sequence

>8fn2S (length=114) Species: 224326 (Borreliella burgdorferi B31) [Search protein sequence]

ARAKNGTVHVARRKRILKKTKGFWGTKKSNYKKAKDTLRKGMMYATRDRK
VRKRDFRRLWISRISAALSDTGVTYSRFIEGLLKSNIKINRKILSNLAIE
DVEAFKKIVLEIRR

3D structure

PDB

8fn2 The structure of a hibernating ribosome in a Lyme disease pathogen.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	A2 R3 K5 N6 H10 R13 R14 K15 R16 K22 F24 W25 G26 K29 Y32 K33 K34 K36 D37 T38 K41 Y45 R48 D49 R50 K51 R53 K54 R55 F57 R58 R59 W61 I62 Y76 S77 R78 E81 N91 R92 K93	A1 R2 K4 N5 H9 R12 R13 K14 R15 K21 F23 W24 G25 K28 Y31 K32 K33 K35 D36 T37 K40 Y44 R47 D48 R49 K50 R52 K53 R54 F56 R57 R58 W60 I61 Y75 S76 R77 E80 N90 R91 K92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8fn2, PDBe:8fn2, PDBj:8fn2
PDBsum	8fn2
PubMed	37907464
UniProt	O51206\|RL20_BORBU Large ribosomal subunit protein bL20 (Gene Name=rplT)