Structure of PDB 8euy Chain S

Receptor sequence

>8euyS (length=168) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

ALKEYQVVGRKVPTEHEPVPKLFRMRLFAPNESVAKSRYWYFLKMINKVK
KATGEIVAINEISEPKPLKAKVFGIWIRYDSRSGTHNMYKEFRDTTRVGA
VEAMYADMAARHRARFRSIRILKVVEVEKKEDVRRNYVKQLLNPHLKFPL
PHRRTKKVFAPHRPSTFY

3D structure

PDB

8euy Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	N61 I63 S64 E65 P66 K67 P68 H87 N88 Y90 K91 A110 A111 R112 H113 R114 R136 L143 N144 P145 L147 H153 R155 P169 H170 R171 P172 S173 T174 F175 Y176	N60 I62 S63 E64 P65 K66 P67 H86 N87 Y89 K90 A109 A110 R111 H112 R113 R135 L142 N143 P144 L146 H152 R154 P161 H162 R163 P164 S165 T166 F167 Y168
BS02	peptide	S	R11 P21 L23 F24 R25 I47 V58 R79 N88 I122 L123	R10 P20 L22 F23 R24 I46 V57 R78 N87 I121 L122

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8euy, PDBe:8euy, PDBj:8euy
PDBsum	8euy
PubMed	36423630
UniProt	P0CT68\|RL20A_SCHPO Large ribosomal subunit protein eL20A (Gene Name=rpl2001)

[Back to BioLiP]