Structure of PDB 8etc Chain S

Receptor sequence

>8etcS (length=168) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

ALKEYQVVGRKVPTEHEPVPKLFRMRLFAPNESVAKSRYWYFLKMINKVK
KATGEIVAINEISEPKPLKAKVFGIWIRYDSRSGTHNMYKEFRDTTRVGA
VEAMYADMAARHRARFRSIRILKVVEVEKKEDVRRNYVKQLLNPHLKFPL
PHRRTKKVFAPHRPSTFY

3D structure

PDB

8etc Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	N61 I63 S64 E65 P66 K67 P68 K70 R83 R94 A110 A111 R112 H113 R114 K131 R136 L143 N144 P145 H153 R154 R155 P169 H170 P172 T174 F175	N60 I62 S63 E64 P65 K66 P67 K69 R82 R93 A109 A110 R111 H112 R113 K130 R135 L142 N143 P144 H152 R153 R154 P161 H162 P164 T166 F167
BS02	peptide	S	V9 R11 P21 L23 F24 R25 M26 I47 V58 L123	V8 R10 P20 L22 F23 R24 M25 I46 V57 L122

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8etc, PDBe:8etc, PDBj:8etc
PDBsum	8etc
PubMed	36423630
UniProt	P0CT68\|RL20A_SCHPO Large ribosomal subunit protein eL20A (Gene Name=rpl2001)

[Back to BioLiP]