Structure of PDB 8d4t Chain S |
>8d4tS (length=91) Species: 9913 (Bos taurus) [Search protein sequence] |
GGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSIT NKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH |
|
PDB | 8d4t Structural basis of mammalian complex IV inhibition by steroids. |
Chain | S |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
S |
C60 C62 C82 C85 |
C57 C59 C79 C82 |
|
|
|
|