Structure of PDB 8cd1 Chain S

Receptor sequence

>8cd1S (length=109) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]

EVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEIMKKVL
ESAVANAEHNEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSC
HITVKVADK

3D structure

PDB

8cd1 70S-PHIKZ014 PHIKZ phage protein occupied ribosome

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	V3 A4 A5 K6 L7 R11 S13 Q15 K16 R18 R25 K41 K42 K49 S53 A56 N57 H60 N61 F75 N77 E78 R80 K83 R84 P87 R88 A89 K90 G91 R92 D94 I96 V97 K98 R99 H102	V2 A3 A4 K5 L6 R10 S12 Q14 K15 R17 R24 K40 K41 K48 S52 A55 N56 H59 N60 F74 N76 E77 R79 K82 R83 P86 R87 A88 K89 G90 R91 D93 I95 V96 K97 R98 H101

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8cd1, PDBe:8cd1, PDBj:8cd1
PDBsum	8cd1
PubMed	38443577
UniProt	Q9HWE0\|RL22_PSEAE Large ribosomal subunit protein uL22 (Gene Name=rplV)