Structure of PDB 8c97 Chain S

Receptor sequence
>8c97S (length=93) Species: 562 (Escherichia coli) [Search protein sequence]
METIAKHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKV
LESAIANAEHNDGADIDDLKVTKIFVDEGPSRTSHITVVVSDR
3D structure
PDB8c97 Cryo-EM captures early ribosome assembly in action.
ChainS
Resolution4.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S I4 K6 H7 R8 H9 R11 R18 A56 N57 H60 N61 D77 E78 P80 I4 K6 H7 R8 H9 R11 R18 A56 N57 H60 N61 D77 E78 P80
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042255 ribosome assembly
GO:0042256 cytosolic ribosome assembly
GO:0046677 response to antibiotic
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c97, PDBe:8c97, PDBj:8c97
PDBsum8c97
PubMed36797249
UniProtP61175|RL22_ECOLI Large ribosomal subunit protein uL22 (Gene Name=rplV)

[Back to BioLiP]