Structure of PDB 7ze3 Chain S

Receptor sequence
>7ze3S (length=94) Species: 1076 (Rhodopseudomonas palustris) [Search protein sequence]
EYKGHSGHPLILKQEGEYKGYSGEPLILKQEGEYKGYSGTPLILEQKGEY
QSFSGTPLILKQEGEYRGFSGAPLILKQDGEYKSFSGYPLLLNI
3D structure
PDB7ze3 Cryo-EM structures of light-harvesting 2 complexes from Rhodopseudomonas palustris reveal the molecular origin of absorption tuning.
ChainS
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL S S57 G58 T59 S54 G55 T56
BS02 BCL S S73 G74 A75 S70 G71 A72
BS03 BCL S S89 G90 Y91 S86 G87 Y88
BS04 BCL S S9 G10 H11 S6 G7 H8
BS05 BCL S S25 G26 E27 S22 G23 E24
BS06 BCL S S41 G42 T43 S38 G39 T40
External links