Structure of PDB 7y7d Chain S

Receptor sequence
>7y7dS (length=84) Species: 562 (Escherichia coli) [Search protein sequence]
PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAV
HNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHAA
3D structure
PDB7y7d Glycosylation of queuosine in tRNAs contributes to optimal translation and post-embryonic growth in vertebrates (Under submission)
ChainS
Resolution2.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna S R3 S4 L5 K6 K7 F10 H14 W34 R36 R37 H52 G54 R55 K70 G72 E73 T77 R78 Y80 H83 R2 S3 L4 K5 K6 F9 H13 W33 R35 R36 H51 G53 R54 K69 G71 E72 T76 R77 Y79 H82
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7y7d, PDBe:7y7d, PDBj:7y7d
PDBsum7y7d
PubMed37992713
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]