Structure of PDB 7xam Chain S

Receptor sequence
>7xamS (length=100) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
TYAIVKTGGKQYKVAAGDVVKVEKLDSEPGASVSLPVALVVDGANVTSKA
DDLAKVAVTAEVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVTGI
3D structure
PDB7xam Cryo-EM structures reveal a unique conformational dynamics of the Mycobacterium 23S rRNA helices
ChainS
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S G10 G11 K12 K23 K26 E66 K69 I73 K77 K79 N80 K81 Y84 K86 R87 Q88 G89 H90 R91 Q92 V96 G8 G9 K10 K21 K24 E64 K67 I71 K75 K77 N78 K79 Y82 K84 R85 Q86 G87 H88 R89 Q90 V94
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xam, PDBe:7xam, PDBj:7xam
PDBsum7xam
PubMed37709237
UniProtA0R151|RL21_MYCS2 Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]