Structure of PDB 7wtx Chain S

Receptor sequence
>7wtxS (length=130) Species: 9606 (Homo sapiens) [Search protein sequence]
LVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDL
TKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANG
LDNKLREDLERLKKIRAHRGLRHFWGLRVR
3D structure
PDB7wtx The nucleoplasmic phase of pre-40S formation prior to nuclear export.
ChainS
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S K25 F28 K34 G35 V36 G37 R38 R39 Y40 W82 F83 N85 R86 Q87 K88 H120 R124 V131 R132 K23 F26 K32 G33 V34 G35 R36 R37 Y38 W80 F81 N83 R84 Q85 K86 H118 R122 V129 R130
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0014069 postsynaptic density
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wtx, PDBe:7wtx, PDBj:7wtx
PDBsum7wtx
PubMed36321656
UniProtP62269|RS18_HUMAN Small ribosomal subunit protein uS13 (Gene Name=RPS18)

[Back to BioLiP]