Structure of PDB 7uvv Chain S

Receptor sequence
>7uvvS (length=91) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEIKKAVEKLF
GVEVVKVNTTITKGKTKRFGRTLGRRSDVKKAYVTLKAGQD
3D structure
PDB7uvv Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
ChainS
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S S16 E17 K18 K39 K44 K56 N58 T60 K63 K65 R75 S77 Y83 S16 E17 K18 K39 K44 K56 N58 T60 K63 K65 R75 S77 Y83
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvv, PDBe:7uvv, PDBj:7uvv
PDBsum7uvv
PubMed37192172
UniProtB7IA37|RL23_ACIB5 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]