Structure of PDB 7umh Chain S

Receptor sequence
>7umhS (length=39) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFH
3D structure
PDB7umh Energetic robustness to large scale structural fluctuations in a photosynthetic supercomplex.
ChainS
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA S N30 D35 L36 N30 D35 L36
BS02 CLA S A11 P12 I15 A11 P12 I15
BS03 CLA S M14 I15 A17 L18 F21 M14 I15 A17 L18 F21
BS04 CLA S M16 L19 A23 M16 L19 A23
BS05 CLA S L18 T22 L26 L18 T22 L26
BS06 CLA S G24 E28 R31 F32 G24 E28 R31 F32
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7umh, PDBe:7umh, PDBj:7umh
PDBsum7umh
PubMed37532717
UniProtQ55329|PSAJ_SYNY3 Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]