Structure of PDB 7ttw Chain S

Receptor sequence

>7ttwS (length=192) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

SIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGGGRKPW
KQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALS
FKVQENGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVEL
SARNIPGVQVTTAQGLNVLDITNADSLVITEAAAKKVEEVLG

3D structure

PDB

7ttw A Structurally Characterized Staphylococcus aureus Evolutionary Escape Route from Treatment with the Antibiotic Linezolid.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	L39 Q40 R41 R45 Q46 T48 R54 R62 K63 Q67 K68 G69 R72 R74 Q75 G76 Q82 R84 G85 F90 P92 R95 K100 P102 K103 K104 M105 R106 P134 K135 T136 K137 K151 L165 N169 N182	L24 Q25 R26 R30 Q31 T33 R39 R47 K48 Q52 K53 G54 R57 R59 Q60 G61 Q67 R69 G70 F75 P77 R80 K85 P87 K88 K89 M90 R91 P119 K120 T121 K122 K136 L150 N154 N167

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ttw, PDBe:7ttw, PDBj:7ttw
PDBsum	7ttw
PubMed	35736238
UniProt	Q2FW07\|RL4_STAA8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]