Structure of PDB 7sae Chain S

Receptor sequence

>7saeS (length=109) Species: 1423 (Bacillus subtilis)

QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVL
KSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTS
HITIVVSEK

3D structure

• PDB: 7sae RbgA ensures the correct timing in the maturation of the 50S subunits functional sites.
• Chain: S
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	A7 R8 R11 R15 K16 P40 R41 A42 A56 N57 N61 Y62 D77 E78 R86 P87 R88 M90 G91 A93 S94	A6 R7 R10 R14 K15 P39 R40 A41 A55 N56 N60 Y61 D76 E77 R85 P86 R87 M89 G90 A92 S93

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7sae, PDBe:7sae, PDBj:7sae
• PDBsum: 7sae
• PubMed: 35141754
• UniProt: P42060|RL22_BACSU Large ribosomal subunit protein uL22 (Gene Name=rplV)