Structure of PDB 7s0s Chain S

Receptor sequence

>7s0sS (length=124) Species: 1772 (Mycolicibacterium smegmatis) [Search protein sequence]

ARVKRALNAQKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLTYAYRDRR
ARKGEFRKLWISRINAAARANDITYNRLIQGLKAAGVEVDRKNLAELAVS
DPAAFTALVDVARAALPEDVNAPS

3D structure

PDB

7s0s 50S subunit recognition and modification by the Mycobacterium tuberculosis ribosomal RNA methyltransferase TlyA.

Chain

Resolution

3.05 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	A2 R3 V4 K5 R6 A7 N9 A10 Q11 K12 R14 R15 K22 G23 Y24 R25 Q27 R28 L31 R33 K34 K36 E37 Q38 H41 S42 Y45 A46 Y47 R48 D49 R50 R51 R53 K54 E56 F57 R58 K59 W61 I62 N66 R70 T75 Y76 N77 R78 I80 Q81 D91 R92 K93 V121 N122 A123 P124	A1 R2 V3 K4 R5 A6 N8 A9 Q10 K11 R13 R14 K21 G22 Y23 R24 Q26 R27 L30 R32 K33 K35 E36 Q37 H40 S41 Y44 A45 Y46 R47 D48 R49 R50 R52 K53 E55 F56 R57 K58 W60 I61 N65 R69 T74 Y75 N76 R77 I79 Q80 D90 R91 K92 V120 N121 A122 P123

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7s0s, PDBe:7s0s, PDBj:7s0s
PDBsum	7s0s
PubMed	35357969
UniProt	A0QYU6\|RL20_MYCS2 Large ribosomal subunit protein bL20 (Gene Name=rplT)