Structure of PDB 7qv3 Chain S

Receptor sequence

>7qv3S (length=109) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVL
KSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTS
HITIVVSEK

3D structure

• PDB: 7qv3 Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue.
• Chain: S
• Resolution: 5.14 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	S	F85 M90	F84 M89
BS02	rna	S	K4 A7 R8 R15 K16 R18 R41 A42 K49 S53 A56 N57 H60 N61 D77 E78 K83 R84 R86 P87 R88 A89 M90 G91 A93 Q95 N97 K98 R99	K3 A6 R7 R14 K15 R17 R40 A41 K48 S52 A55 N56 H59 N60 D76 E77 K82 R83 R85 P86 R87 A88 M89 G90 A92 Q94 N96 K97 R98

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qv3, PDBe:7qv3, PDBj:7qv3
• PDBsum: 7qv3
• PubMed: 35264791
• UniProt: P42060|RL22_BACSU Large ribosomal subunit protein uL22 (Gene Name=rplV)