Structure of PDB 7po2 Chain S |
>7po2S (length=135) Species: 9606 (Homo sapiens) [Search protein sequence] |
AGSRLETVGSIFSRTRDLVRAGVLKEKPLWFDVYDAFPPLREPVFQRPRV RYGKAKAPIQDIWYHEDRIRAKFYSVYGSGQRAFDLFNPNFKSTCQRFVE KYTELQKLGETDEEKLFVETGKALLAEGVILRRVG |
|
PDB | 7po2 Mechanism of mitoribosomal small subunit biogenesis and preinitiation. |
Chain | S |
Resolution | 3.09 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
S |
R5 R48 R50 Y53 |
R4 R47 R49 Y52 |
|
|
|
|