Structure of PDB 7pib Chain S

Receptor sequence
>7pibS (length=77) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
NIKSNEKRLRQNIKRNLNNKGQKTKLKTNVKNFHKEINLDNLGNVYSQAD
RLARKGIISTNRARRLKSRNVAVLNKT
3D structure
PDB7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainS
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S N3 I4 S6 N7 K9 R10 Q13 R17 N18 T26 K29 Y48 S49 D52 R53 R56 N63 R64 R66 R67 R71 V73 N77 N1 I2 S4 N5 K7 R8 Q11 R15 N16 T24 K27 Y46 S47 D50 R51 R54 N61 R62 R64 R65 R69 V71 N75
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pib, PDBe:7pib, PDBj:7pib
PDBsum7pib
PubMed36171285
UniProtP75237|RS20_MYCPN Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]