Structure of PDB 7p7q Chain S

Receptor sequence
>7p7qS (length=114) Species: 1351 (Enterococcus faecalis) [Search protein sequence]
NPLIQELTQEQLRTDIPAFRPGDTVRVHAKVVEGTRERIQLFEGVVIKRR
GAGISETYTVRKVSNGVGVERTFPLHTPRVAQIEVVRYGKVRRAKLYYLR
ALHGKAARIKEIRR
3D structure
PDB7p7q Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
ChainS
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S N2 P3 R21 R51 S56 T58 K91 R93 R94 A95 K96 Y98 Y99 N1 P2 R20 R50 S55 T57 K90 R92 R93 A94 K95 Y97 Y98
BS02 rna S R37 R39 Q41 G105 K106 R109 R114 R36 R38 Q40 G104 K105 R108 R113
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p7q, PDBe:7p7q, PDBj:7p7q
PDBsum7p7q
PubMed35387982
UniProtQ833P5|RL19_ENTFA Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]