Structure of PDB 7oui Chain S

Receptor sequence

>7ouiS (length=216) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

DELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPEN
FAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLD
GNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPF
DPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAK
HLSDPFGNNLLTVIAG

3D structure

PDB

7oui High-resolution model of Arabidopsis Photosystem II reveals the structural consequences of digitonin-extraction.

Chain

Resolution

2.79 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	S	P72 G74 L75	P16 G18 L19
BS02	CHL	S	F70 L71 P72 Y93 Y95	F14 L15 P16 Y37 Y39
BS03	CLA	S	D92 Y95 D96 Y110 Q111 E114 R230 M233	D36 Y39 D40 Y54 Q55 E58 R174 M177
BS04	CLA	S	Y110 F113 H117	Y54 F57 H61
BS05	CLA	S	L123 G124 P131 C141 G142 N161	L67 G68 P75 C85 G86 N105
BS06	CHL	S	W120 L154 I169 E178	W64 L98 I113 E122
BS07	CHL	S	F148 G151 A152 E178	F92 G95 A96 E122
BS08	CHL	S	R119 W120 A185 R189 N192 L194 F196 K199 L200 P202 F206	R63 W64 A129 R133 N136 L138 F140 K143 L144 P146 F150
BS09	CLA	S	F113 I116 H117 W120 E186 R189	F57 I60 H61 W64 E130 R133
BS10	CLA	S	R119 M122 H201 P202 F206 L211 L221 K222 E225 N228	R63 M66 H145 P146 F150 L155 L165 K166 E169 N172
BS11	CLA	S	V223 K224 K227 N228	V167 K168 K171 N172
BS12	CLA	S	K224 N228 L231	K168 N172 L175
BS13	CLA	S	F234 G238 I241 Q242 T246 N253 H257 L266 V269	F178 G182 I185 Q186 T190 N197 H201 L210 V213
BS14	CLA	S	H257 L258 P261 F262 N265	H201 L202 P205 F206 N209
BS15	AJP	S	E178 V179	E122 V123
BS16	CHL	S	L134 Y137	L78 Y81

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7oui, PDBe:7oui, PDBj:7oui
PDBsum	7oui
PubMed	34330992
UniProt	Q9XF89\|CB5_ARATH Chlorophyll a-b binding protein CP26, chloroplastic (Gene Name=LHCB5)

[Back to BioLiP]