Structure of PDB 7nwi Chain S

Receptor sequence

>7nwiS (length=175) Species: 9986 (Oryctolagus cuniculus)

KASGTLREYKVVGRCLPTPKCRTPPLYRMRIFAPNHVVAKSRFWYFVSQL
KKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLT
TAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKIK
FPLPHRVLRRQHKPRFTTKRPNTFF

3D structure

• PDB: 7nwi Blasticidin S inhibits mammalian translation and enhances production of protein encoded by nonsense mRNA.
• Chain: S
• Resolution: 3.13 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	A3 S4 R8 Y63 F68 R87 Y94 R111 G114 R116 H117 R118 A134 R139 S148 R157 V158 R160 R161 H163 P165 R166 K170 R171 P172 N173 T174 F175 F176	A2 S3 R7 Y62 F67 R86 Y93 R110 G113 R115 H116 R117 A133 R138 S147 R156 V157 R159 R160 H162 P164 R165 K169 R170 P171 N172 T173 F174 F175
BS02	rna	S	Y46 S49 K52 K53 K55	Y45 S48 K51 K52 K54

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 21:34:55 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7nwi', asym_id = 'S', title = 'Blasticidin S inhibits mammalian translation and...s production of protein encoded by nonsense mRNA.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7nwi', asym_id='S', title='Blasticidin S inhibits mammalian translation and...s production of protein encoded by nonsense mRNA.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7nwi', asym_id = 'S'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7nwi', asym_id='S')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>