Structure of PDB 7nhl Chain S

Receptor sequence
>7nhlS (length=114) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
TNHKLIEAVTKSQLRTDLPSFRPGDTLRVHVRIIEGTRERIQVFEGVVIK
RRGGGVSETFTVRKISSGVGVERTFPLHTPKIEKIEVKRRGKVRRAKLYY
LRSLRGKAARIQEI
3D structure
PDB7nhl Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
ChainS
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S T2 R23 K51 R53 G54 G55 T60 R95 R96 A97 K98 Y100 Y101 T1 R22 K50 R52 G53 G54 T59 R94 R95 A96 K97 Y99 Y100
BS02 rna S R41 G107 K108 R111 R40 G106 K107 R110
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nhl, PDBe:7nhl, PDBj:7nhl
PDBsum7nhl
PubMed34117249
UniProtQ2FZ42|RL19_STAA8 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]