Structure of PDB 7msc Chain S

Receptor sequence

>7mscS (length=113) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]

EYPSAVAKARFVRVSPRKARRVIDLVRGRSVSDALDILRWAPQAASGPVA
KVIASAAANAQNNGGLDPATLVVATVYADQGPTAKRIRPRAQGRAFRIRR
RTSHITVVVESRP

3D structure

PDB

7msc Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.

Chain

Resolution

2.97 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	V14 K16 A17 R18 F19 R21 S23 R25 K26 R28 R29 R35 Q51 A52 K59 S63 A66 N67 N70 N71 D87 Q88 R94 P97 R98 A99 Q100 G101 R102 A103 F104 R105 I106 R107 R108 H112	V6 K8 A9 R10 F11 R13 S15 R17 K18 R20 R21 R27 Q43 A44 K51 S55 A58 N59 N62 N63 D79 Q80 R86 P89 R90 A91 Q92 G93 R94 A95 F96 R97 I98 R99 R100 H104

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0009274	peptidoglycan-based cell wall
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7msc, PDBe:7msc, PDBj:7msc
PDBsum	7msc
PubMed	35064151
UniProt	P9WHC1\|RL22_MYCTU Large ribosomal subunit protein uL22 (Gene Name=rplV)