Structure of PDB 7mdz Chain S

Receptor sequence

>7mdzS (length=176) Species: 9986 (Oryctolagus cuniculus)

MKASGTLREYKVVGRCLPTPKCRTPPLYRMRIFAPNHVVAKSRFWYFVSQ
LKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDL
TTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKI
KFPLPHRVLRRQHKPRFTTKRPNTFF

3D structure

• PDB: 7mdz Discovery of C13-Aminobenzoyl Cycloheximide Derivatives that Potently Inhibit Translation Elongation.
• Chain: S
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	K2 A3 S4 G5 R23 Y63 Q66 V67 F68 E69 K70 S86 R87 S88 N92 M93 Y94 R95 R98 R111 G114 A115 R116 H117 R118 A134 R139 H146 D147 S148 P155 H156 R157 V158 R160 R161 H163 R166 T169 K170 R171 P172 N173 T174 F175 F176	K2 A3 S4 G5 R23 Y63 Q66 V67 F68 E69 K70 S86 R87 S88 N92 M93 Y94 R95 R98 R111 G114 A115 R116 H117 R118 A134 R139 H146 D147 S148 P155 H156 R157 V158 R160 R161 H163 R166 T169 K170 R171 P172 N173 T174 F175 F176
BS02	rna	S	S42 Y46 S49 K52 K53 K55 K56 S57 R87 R120 H122	S42 Y46 S49 K52 K53 K55 K56 S57 R87 R120 H122

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:7mdz, PDBe:7mdz, PDBj:7mdz
• PDBsum: 7mdz
• PubMed: 34403584
• UniProt: G1TTY7|RL18A_RABIT Large ribosomal subunit protein eL20 (Gene Name=RPL18A)