Structure of PDB 6woo Chain S

Receptor sequence

>6wooS (length=169) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

FKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKVKK
ASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVAAV
ETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFPLP
HRVQKSTKTFSYKRPSTFY

3D structure

PDB

6woo An active role of the eukaryotic large ribosomal subunit in translation initiation fidelity.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	N62 N65 E66 H68 P69 K71 S83 R84 H88 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 Y139 K146 P153 H154 R155 Q157 K158 S159 K161 Y165 S169 T170 F171	N59 N62 E63 H65 P66 K68 S80 R81 H85 M87 Y88 K89 Q105 A108 A109 R110 H111 R112 R114 T129 R134 Y136 K143 P150 H151 R152 Q154 K155 S156 K158 Y162 S166 T167 F168
BS02	rna	S	Y43 Q46 H49 K50 K52 D82 R84 R117 R119	Y40 Q43 H46 K47 K49 D79 R81 R114 R116

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6woo, PDBe:6woo, PDBj:6woo
PDBsum	6woo
PubMed
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]