Structure of PDB 6ri5 Chain S

Receptor sequence

>6ri5S (length=171) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKV
KKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVA
AVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFP
LPHRVQKSTKTFSYKRPSTFY

3D structure

PDB

6ri5 Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	A2 N62 N65 A67 H68 S83 R84 H88 Y91 Q108 A111 A112 R113 H114 R115 R117 T132 R137 Y139 K146 R155 K158 S159 Y165 T170 F171	A1 N61 N64 A66 H67 S82 R83 H87 Y90 Q107 A110 A111 R112 H113 R114 R116 T131 R136 Y138 K145 R154 K157 S158 Y164 T169 F170
BS02	rna	S	R13 K23 S39 Y43 Q46 K50 K52 K53 R119	R12 K22 S38 Y42 Q45 K49 K51 K52 R118

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ri5, PDBe:6ri5, PDBj:6ri5
PDBsum	6ri5
PubMed	31115337
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]