Structure of PDB 6ppk Chain S

Receptor sequence
>6ppkS (length=109) Species: 1423 (Bacillus subtilis) [Search protein sequence]
QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVL
KSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTS
HITIVVSEK
3D structure
PDB6ppk Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
ChainS
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S V6 A7 R8 R11 R15 K16 R18 R25 P40 R41 A42 K49 K52 S53 N57 H60 N61 D77 E78 P80 R84 R86 P87 R88 A89 M90 G91 N97 K98 R99 V5 A6 R7 R10 R14 K15 R17 R24 P39 R40 A41 K48 K51 S52 N56 H59 N60 D76 E77 P79 R83 R85 P86 R87 A88 M89 G90 N96 K97 R98
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppk, PDBe:6ppk, PDBj:6ppk
PDBsum6ppk
PubMed31665744
UniProtP42060|RL22_BACSU Large ribosomal subunit protein uL22 (Gene Name=rplV)

[Back to BioLiP]