Structure of PDB 6pfy Chain S

Receptor sequence
>6pfyS (length=41) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
MKHFLTYLSTAPVLAAIWMTITAGILIEFNRFYPDLLFHPL
3D structure
PDB6pfy Membrane protein megahertz crystallography at the European XFEL.
ChainS
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA S A11 L14 A15 W18 A11 L14 A15 W18
BS02 CLA S F29 D35 L36 L37 F29 D35 L36 L37
BS03 CLA S W18 M19 W18 M19
BS04 CLA S Y7 A11 P12 A15 A16 Y7 A11 P12 A15 A16
BS05 CLA S I21 G24 E28 R31 I21 G24 E28 R31
BS06 CLA S F29 H39 L41 F29 H39 L41
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6pfy, PDBe:6pfy, PDBj:6pfy
PDBsum6pfy
PubMed31685819
UniProtP0A429|PSAJ_THEVB Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]