Structure of PDB 6o9l Chain S

Receptor sequence
>6o9lS (length=176) Species: 9606 (Homo sapiens) [Search protein sequence]
GPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNK
KIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNG
KSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRT
LTAEEAEEEWERRNKVLNHFSIMQQR
3D structure
PDB6o9l Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
ChainS
Resolution7.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna S R80 R167 R76 R163
Gene Ontology
Molecular Function
GO:0001091 RNA polymerase II general transcription initiation factor binding
GO:0001096 TFIIF-class transcription factor complex binding
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0019211 phosphatase activator activity
GO:0019903 protein phosphatase binding
GO:0019904 protein domain specific binding
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0009615 response to virus
GO:0032091 negative regulation of protein binding
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005674 transcription factor TFIIF complex
GO:0030054 cell junction
GO:0032991 protein-containing complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6o9l, PDBe:6o9l, PDBj:6o9l
PDBsum6o9l
PubMed31110295
UniProtP35269|T2FA_HUMAN General transcription factor IIF subunit 1 (Gene Name=GTF2F1)

[Back to BioLiP]