Structure of PDB 6nqb Chain S

Receptor sequence

>6nqbS (length=74) Species: 656414 (Escherichia coli H736)

GPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQH
VPVFVTDEMVGHKLGEFAPTRTYR

3D structure

• PDB: 6nqb Role of Era in assembly and homeostasis of the ribosomal small subunit.
• Chain: S
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	F9 H13 K17 W33 R35 R36 H51 N52 G53 R54 K69 G71 T76 R77 T78 Y79	F3 H7 K11 W27 R29 R30 H45 N46 G47 R48 K63 G65 T70 R71 T72 Y73

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 22:38:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6nqb', asym_id = 'S', title = 'Role of Era in assembly and homeostasis of the ribosomal small subunit.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6nqb', asym_id='S', title='Role of Era in assembly and homeostasis of the ribosomal small subunit.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015935', uniprot = '', pdbid = '6nqb', asym_id = 'S'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015935', uniprot='', pdbid='6nqb', asym_id='S')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>