Structure of PDB 6nmf Chain S |
>6nmfS (length=98) Species: 9913 (Bos taurus) [Search protein sequence] |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVP SITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH |
|
PDB | 6nmf Snapshot of an oxygen intermediate in the catalytic reaction of cytochromecoxidase. |
Chain | S |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
S |
C60 C62 C82 C85 |
C60 C62 C82 C85 |
|
|
|
|