Structure of PDB 6n8j Chain S

Receptor sequence

>6n8jS (length=170) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

AHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKV
KKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVA
AVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFP
LPHRVQKSTKTFSYKRPSTF

3D structure

PDB

6n8j Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	A2 N62 N65 H68 P69 K71 S83 R84 S85 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 Y139 L144 K146 H154 K158 S159 S164 Y165 S169 T170	A1 N61 N64 H67 P68 K70 S82 R83 S84 M89 Y90 K91 Q107 A110 A111 R112 H113 R114 R116 T131 Y138 L143 K145 H153 K157 S158 S163 Y164 S168 T169
BS02	rna	S	R13 S39 Y43 Q46 K50 V51 K52 R119	R12 S38 Y42 Q45 K49 V50 K51 R118

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6n8j, PDBe:6n8j, PDBj:6n8j
PDBsum	6n8j
PubMed	30814529
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]