Structure of PDB 6mte Chain S

Receptor sequence

>6mteS (length=176) Species: 9986 (Oryctolagus cuniculus)

MKASGTLREYKVVGRCLPTPKCRTPPLYRMRIFAPNHVVAKSRFWYFVSQ
LKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDL
TTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKI
KFPLPHRVLRRQHKPRFTTKRPNTFF

3D structure

• PDB: 6mte Structures of translationally inactive mammalian ribosomes.
• Chain: S
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	K2 A3 S4 G5 R23 Y63 Q66 V67 F68 K70 P72 S86 R87 N92 M93 R95 R98 R111 G114 A115 R116 H117 R118 R120 A134 R139 H146 D147 K149 P155 H156 R160 R161 H163 R166 T169 K170 R171 N173 T174 F175 F176	K2 A3 S4 G5 R23 Y63 Q66 V67 F68 K70 P72 S86 R87 N92 M93 R95 R98 R111 G114 A115 R116 H117 R118 R120 A134 R139 H146 D147 K149 P155 H156 R160 R161 H163 R166 T169 K170 R171 N173 T174 F175 F176
BS02	rna	S	S42 R43 Y46 S49 K53 K55 K56 S57 R87 R120 H122	S42 R43 Y46 S49 K53 K55 K56 S57 R87 R120 H122

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:6mte, PDBe:6mte, PDBj:6mte
• PDBsum: 6mte
• PubMed: 30355441
• UniProt: A0A287APR1