Structure of PDB 6j6n Chain S

Receptor sequence
>6j6nS (length=70) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TSHRPQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKSWRKGTAFGRG
YINDMTKSEYHQEFLHKHVR
3D structure
PDB6j6n Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
ChainS
Resolution3.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S R29 P32 G33 H34 T35 R27 P30 G31 H32 T33
BS02 rna S T3 S4 H5 R6 Q8 R12 K16 I25 H27 R29 L30 T1 S2 H3 R4 Q6 R10 K14 I23 H25 R27 L28
BS03 rna S H5 R6 P7 L9 H3 R4 P5 L7
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6j6n, PDBe:6j6n, PDBj:6j6n
PDBsum6j6n
PubMed30879786
UniProtQ03772|CWC15_YEAST Pre-mRNA-splicing factor CWC15 (Gene Name=CWC15)

[Back to BioLiP]