Structure of PDB 6g94 Chain S

Receptor sequence
>6g94S (length=296) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
NKPRIPVVWIHGLECTGCTESFIRSAHPLAKDVILSLISLDYDDTLMAAA
GTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRA
AAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPI
PDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFV
QSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGC
AENGFWDRGSFYSRVVDIPQMGTHSTADTVGLTALGVVAAAVGVHA
3D structure
PDB6g94 X-ray structural, functional and computational studies of the O2-sensitive E. coli hydrogenase-1 C19G variant reveal an unusual [4Fe-4S] cluster.
ChainS
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.12.99.6: hydrogenase (acceptor).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 S H187 C190 R193 F196 C215 L216 Y217 C221 P224 I243 H185 C188 R191 F194 C213 L214 Y215 C219 P222 I241
BS02 F3S S N228 C230 P242 C249 L250 C252 N226 C228 P240 C247 L248 C250
BS03 ER2 S C17 G19 C20 G113 C115 C120 C149 P150 C15 G17 C18 G111 C113 C118 C147 P148
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008901 ferredoxin hydrogenase activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0033748 hydrogenase (acceptor) activity
GO:0046872 metal ion binding
GO:0051536 iron-sulfur cluster binding
GO:0051538 3 iron, 4 sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006113 fermentation
GO:0009061 anaerobic respiration
GO:0009267 cellular response to starvation
GO:0019645 anaerobic electron transport chain
GO:1902421 hydrogen metabolic process
Cellular Component
GO:0005886 plasma membrane
GO:0009375 ferredoxin hydrogenase complex
GO:0016020 membrane
GO:0044569 [Ni-Fe] hydrogenase complex
GO:0098567 periplasmic side of plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6g94, PDBe:6g94, PDBj:6g94
PDBsum6g94
PubMed29888350
UniProtP69739|MBHS_ECOLI Hydrogenase-1 small chain (Gene Name=hyaA)

[Back to BioLiP]