Structure of PDB 6ftj Chain S

Receptor sequence

>6ftjS (length=175) Species: 9986 (Oryctolagus cuniculus)

KASGTLREYKVVGRCLPTPKCRTPPLYRMRIFAPNHVVAKSRFWYFVSQL
KKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLT
TAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKIK
FPLPHRVLRRQHKPRFTTKRPNTFF

3D structure

• PDB: 6ftj Structural basis for coupling protein transport and N-glycosylation at the mammalian endoplasmic reticulum.
• Chain: S
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	S4 G5 R8 Y63 V67 F68 K70 P72 S86 R87 S88 H91 N92 M93 Y94 R95 R111 G114 A115 R116 H117 R118 R120 R139 P155 H156 R157 R160 R161 H163 P165 R166 T168 T169 K170 R171 P172 N173 T174 F175 F176	S3 G4 R7 Y62 V66 F67 K69 P71 S85 R86 S87 H90 N91 M92 Y93 R94 R110 G113 A114 R115 H116 R117 R119 R138 P154 H155 R156 R159 R160 H162 P164 R165 T167 T168 K169 R170 P171 N172 T173 F174 F175
BS02	rna	S	S42 Y46 S49 Q50 K53 K55 K56 S57 R87 H122	S41 Y45 S48 Q49 K52 K54 K55 S56 R86 H121

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 07:41:25 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6ftj', asym_id = 'S', title = 'Structural basis for coupling protein transport ...osylation at the mammalian endoplasmic reticulum.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6ftj', asym_id='S', title='Structural basis for coupling protein transport ...osylation at the mammalian endoplasmic reticulum.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6ftj', asym_id = 'S'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6ftj', asym_id='S')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>