Structure of PDB 5zwn Chain S

Receptor sequence

>5zwnS (length=131) Species: 559292 (Saccharomyces cerevisiae S288C)

ALYFQNLPSRPANKENYTRLLLKHINPNNKYAINPSLPLPHNKLLDDQMG
LLEVSISRSSKMTNQAFLTFVTQEEADRFLEKYTTTALKVQGRKVRMGKA
RTNSLLGLSIEMQKTYNLDIKKVLKARKLKR

3D structure

• PDB: 5zwn Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
• Chain: S
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	Y5 Q7 R12 P13 A14 N15 K16 S66 I67 S68 R69 K72 N75 Q76 F78 K100 Q102 G103 R104 K105 L116 K139	Y3 Q5 R10 P11 A12 N13 K14 S55 I56 S57 R58 K61 N64 Q65 F67 K89 Q91 G92 R93 K94 L105 K122

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0030619 U1 snRNA binding

Biological Process

• GO:0000395 mRNA 5'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0000243 commitment complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005685 U1 snRNP
• GO:0071004 U2-type prespliceosome

External links

• PDB: RCSB:5zwn, PDBe:5zwn, PDBj:5zwn
• PDBsum: 5zwn
• PubMed: 29794219
• UniProt: P32605|RU1A_YEAST U1 small nuclear ribonucleoprotein A (Gene Name=MUD1)