Structure of PDB 5zeb Chain S

Receptor sequence
>5zebS (length=102) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
ATYAIVKTGGKQYKVAAGDVVKVEKLDSEPGASVSLPVALVVDGANVTSK
ADDLAKVAVTAEVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVTG
IK
3D structure
PDB5zeb Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
ChainS
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S G10 K12 V21 K23 E25 K26 E66 K69 K72 R74 F78 K79 N80 K81 T82 Y84 K86 R87 G89 H90 R91 Q92 Q93 G9 K11 V20 K22 E24 K25 E65 K68 K71 R73 F77 K78 N79 K80 T81 Y83 K85 R86 G88 H89 R90 Q91 Q92
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zeb, PDBe:5zeb, PDBj:5zeb
PDBsum5zeb
PubMed30206241
UniProtA0R151|RL21_MYCS2 Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]