Structure of PDB 5xdq Chain S |
>5xdqS (length=94) Species: 9913 (Bos taurus) [Search protein sequence] |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVP SITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH |
|
PDB | 5xdq Structure of bovine cytochrome c oxidase crystallized at a neutral pH using a fluorinated detergent. |
Chain | S |
Resolution | 1.77 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
S |
C60 C62 C82 C85 |
C60 C62 C82 C85 |
|
|
|
|