Structure of PDB 5wsg Chain S

Receptor sequence
>5wsgS (length=69) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SHRPQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKSWRKGTAFGRGY
INDMTKSEYHQEFLHKHVR
3D structure
PDB5wsg Structure of a yeast step II catalytically activated spliceosome
ChainS
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S R29 P32 H34 T35 R26 P29 H31 T32
BS02 rna S S4 R6 Q8 R12 K16 H27 L30 S1 R3 Q5 R9 K13 H24 L27
BS03 rna S H5 R6 P7 H2 R3 P4
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wsg, PDBe:5wsg, PDBj:5wsg
PDBsum5wsg
PubMed27980089
UniProtQ03772|CWC15_YEAST Pre-mRNA-splicing factor CWC15 (Gene Name=CWC15)

[Back to BioLiP]