Structure of PDB 5jbh Chain S

Receptor sequence
>5jbhS (length=67) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
MGKIRQGFIKRVARELVNKYPNEFTTDFEHNKKKVQELTNVTSKKIRNRI
AGYVTKLVRMKMEGKIL
3D structure
PDB5jbh Cryo-EM study of start codon selection during archaeal translation initiation.
ChainS
Resolution5.34 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S M1 G2 K3 I4 R5 Q6 G7 F28 K44 N48 R49 G52 K56 E63 L67 M1 G2 K3 I4 R5 Q6 G7 F28 K44 N48 R49 G52 K56 E63 L67
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jbh, PDBe:5jbh, PDBj:5jbh
PDBsum5jbh
PubMed27819266
UniProtQ8U0U1|RS17E_PYRFU Small ribosomal subunit protein eS17 (Gene Name=rps17e)

[Back to BioLiP]