Structure of PDB 5imq Chain S

Receptor sequence
>5imqS (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
ChainS
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S Q9 D21 T22 G23 Q28 L31 R35 H42 H46 K48 D49 H50 H51 R54 G55 M58 R64 R65 Y69 R72 Q8 D20 T21 G22 Q27 L30 R34 H41 H45 K47 D48 H49 H50 R53 G54 M57 R63 R64 Y68 R71
BS02 rna S I36 H53 L56 V60 R88 I35 H52 L55 V59 R87
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5imq, PDBe:5imq, PDBj:5imq
PDBsum5imq
PubMed27137929
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]