Structure of PDB 4v8t Chain S

Receptor sequence

>4v8tS (length=172) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MAHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHK
VKKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRV
AAVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKF
PLPHRVQKSTKTFSYKRPSTFY

3D structure

PDB

4v8t Cryo-Em Structures of Arx1 and Maturation Factors Rei1 and Jjj1 Bound to the 60S Ribosomal Subunit

Chain

Resolution

8.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	A2 N62 N65 E66 H68 K71 S83 R84 S85 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 K141 L144 T145 K146 P153 H154 R155 Q157 K158 K161 Y165 P168 S169 T170 F171	A2 N62 N65 E66 H68 K71 S83 R84 S85 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 K141 L144 T145 K146 P153 H154 R155 Q157 K158 K161 Y165 P168 S169 T170 F171
BS02	rna	S	R13 S39 Y43 Q46 H49 K50 K52 K53 R84 R119	R13 S39 Y43 Q46 H49 K50 K52 K53 R84 R119

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8t, PDBe:4v8t, PDBj:4v8t
PDBsum	4v8t
PubMed	23142985
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]