Structure of PDB 4kl8 Chain S

Receptor sequence

>4kl8S (length=279) Species: 899 (Desulfomicrobium baculatum)

AKKAPVIWVQGQGCTGCSVSLLNAVHPRIKEILLDVISLEFHPTVMASEG
EMALAHMYEIAEKFNGNFFLLVEGAIPTAKEGRYCIVGETLDAKGHHHEV
TMMELIRDLAPKSLATVAVGTCSAYGGIPAAEGNVTGSKSVRDFFADEKI
EKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPLLFFG
DNIHENCPYLDKYDNSEFAETFTKPGCKAELGCKGPSTYADCAKRRWNNG
INWCVENAVCIGCVEPDFPDGKSPFYVAE

3D structure

• PDB: 4kl8 Structural foundations for the O2 resistance of Desulfomicrobium baculatum [NiFeSe]-hydrogenase.
• Chain: S
• Resolution: 1.52 Å

Enzymatic activity

• Enzyme Commision number: 1.12.99.6: hydrogenase (acceptor).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	S	H208 C211 Y213 L214 C231 K232 A233 C237 V259	H204 C207 Y209 L210 C227 K228 A229 C233 V255
BS02	SF4	S	C246 W251 C258 C264 I265 C267	C242 W247 C254 C260 I261 C263
BS03	SF4	S	C18 G20 C21 G124 C126 C164 P165	C14 G16 C17 G120 C122 C160 P161

Gene Ontology

Molecular Function

• GO:0008901 ferredoxin hydrogenase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0033748 hydrogenase (acceptor) activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0009375 ferredoxin hydrogenase complex
• GO:0016020 membrane
• GO:0042597 periplasmic space
• GO:0044569 [Ni-Fe] hydrogenase complex

External links

• PDB: RCSB:4kl8, PDBe:4kl8, PDBj:4kl8
• PDBsum: 4kl8
• PubMed: 23811828
• UniProt: P13063|PHSS_DESBA Periplasmic [NiFeSe] hydrogenase small subunit