Structure of PDB 4iuc Chain S

Receptor sequence
>4iucS (length=265) Species: 381666 (Cupriavidus necator H16) [Search protein sequence]
PRTPVLWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAAAGH
QAEAILEEIMTKYKGNYILAVEGNPPLNQDGMSCIIGGRPFIEQLKYVAK
DAKAIISWGSCASWGCVQAAKPNPTQATPVHKVITDKPIIKVPGCPPIAE
VMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEE
WDDESARKGFCLYKMGCKGPTTYNACSTTRWNEGTSFPIQSGHGCIGCSE
DGFWDKGSFYDRLTG
3D structure
PDB4iuc Reversible [4Fe-3S] cluster morphing in an O2-tolerant [NiFe] hydrogenase.
ChainS
Resolution1.45 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C149 P242 C249 C252
Catalytic site (residue number reindexed from 1) C145 P238 C245 C248
Enzyme Commision number 1.12.99.6: hydrogenase (acceptor).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 S H187 C190 R192 R193 C215 L216 Y217 C221 P224 I243 H183 C186 R188 R189 C211 L212 Y213 C217 P220 I239
BS02 F3S S N228 C230 W235 P242 C249 I250 C252 N224 C226 W231 P238 C245 I246 C248
BS03 S3F S C17 T18 C19 C20 E76 S114 C115 C120 C149 C13 T14 C15 C16 E72 S110 C111 C116 C145
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008901 ferredoxin hydrogenase activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0033748 hydrogenase (acceptor) activity
GO:0046872 metal ion binding
GO:0051536 iron-sulfur cluster binding
GO:0051538 3 iron, 4 sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009061 anaerobic respiration
Cellular Component
GO:0005886 plasma membrane
GO:0009375 ferredoxin hydrogenase complex
GO:0016020 membrane
GO:0044569 [Ni-Fe] hydrogenase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4iuc, PDBe:4iuc, PDBj:4iuc
PDBsum4iuc
PubMed24705592
UniProtP31892|MBHS_CUPNH Uptake hydrogenase small subunit (Gene Name=hoxK)

[Back to BioLiP]