Structure of PDB 3j7r Chain S

Receptor sequence

>3j7rS (length=175) Species: 9823 (Sus scrofa)

KASGTLREYKVVGRCLPTPKCRTPPLYRMRIFAPNHVVAKSRFWYFVSQL
KKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLT
TAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKIK
FPLPHRVLRRQHKPRFTTKRPNTFF

3D structure

• PDB: 3j7r Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.
• Chain: S
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	A3 S4 G5 R8 Y63 F68 E69 P72 L73 R74 R87 S88 H91 N92 M93 Y94 R95 R111 G114 A115 R116 H117 R118 R120 R139 P155 H156 R157 V158 R160 R161 H163 P165 R166 T168 T169 K170 R171 P172 N173 T174 F175 F176	A2 S3 G4 R7 Y62 F67 E68 P71 L72 R73 R86 S87 H90 N91 M92 Y93 R94 R110 G113 A114 R115 H116 R117 R119 R138 P154 H155 R156 V157 R159 R160 H162 P164 R165 T167 T168 K169 R170 P171 N172 T173 F174 F175
BS02	rna	S	S42 R43 Y46 S49 Q50 K52 K53 K55 K56 S57 D85 R87 R120 H122	S41 R42 Y45 S48 Q49 K51 K52 K54 K55 S56 D84 R86 R119 H121

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j7r, PDBe:3j7r, PDBj:3j7r
• PDBsum: 3j7r
• PubMed: 24930395
• UniProt: A0A287APR1