Structure of PDB 3j3w Chain S

Receptor sequence

>3j3wS (length=112) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKV
LKSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRT
SHITIVVSEKKE

3D structure

• PDB: 3j3w Cryo-EM structures of the late-stage assembly intermediates of the bacterial 50S ribosomal subunit
• Chain: S
• Resolution: 10.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	K4 V6 A7 R8 R11 R15 K16 R18 R25 P40 R41 A42 K49 S53 N57 H60 N61 Y62 Q73 F75 V76 D77 E78 G79 P80 R84 R86 P87 R88 A89 M90 G91 R92 N97 K98 R99 H102	K4 V6 A7 R8 R11 R15 K16 R18 R25 P40 R41 A42 K49 S53 N57 H60 N61 Y62 Q73 F75 V76 D77 E78 G79 P80 R84 R86 P87 R88 A89 M90 G91 R92 N97 K98 R99 H102

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j3w, PDBe:3j3w, PDBj:3j3w
• PDBsum: 3j3w
• PubMed: 23700310
• UniProt: P42060|RL22_BACSU Large ribosomal subunit protein uL22 (Gene Name=rplV)