Structure of PDB 3asn Chain S |
>3asnS (length=98) Species: 9913 (Bos taurus) [Search protein sequence] |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVP SITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH |
|
PDB | 3asn Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase |
Chain | S |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
1.9.3.1: Transferred entry: 7.1.1.9. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
S |
C60 C62 C82 C85 |
C60 C62 C82 C85 |
|
|
|
|